70% 80% 90% 100% BioSci M160 / MolBio255 Structure-Function Relationships of Int

70% 80% 90% 100% BioSci M160 / MolBio255 Structure-Function Relationships of Int www.phwiki.com

70% 80% 90% 100% BioSci M160 / MolBio255 Structure-Function Relationships of Int

Bell, Allie, Managing Editor has reference to this Academic Journal, PHwiki organized this Journal 70% 80% 90% 100% BioSci M160 / MolBio255 Structure-Function Relationships of Integral Membrane Proteins Lecture 3 Hartmut “Hudel” Luecke Biochemistry, Biophysics & Computer Science Email: hudel@uci.edu http://urei.bio.uci.edu/~hudel Wet lab tour (protein production, purification, crystallization) X-ray lab virtual tour (data collection at the Stan as long as d Synchrotron!) 3D structure visualization (programs Coot, Pymol etc.)

Clarke College US www.phwiki.com

This Particular University is Related to this Particular Journal

Without a crystal structure Nucleotide sequence: GAGCCCACGAGAGGCAGCGCCATGGCGGAGCAGACCTACTCGTGGGCCTATTCCCTGGTGGATTCCAGTCAAGTGT CTACATTTCTGATTTCCATTCTTCTTATAGTCTATGGTAGTTTCAGGTCCCTTAATATGGACTTTGAAAATCAAGA TAAGGAGAAAGACAGTAATAGTTCTTCTGGGTCTTTCAATGGGGAACAGGAACCAATAATTGGCTTCCAACCAATG GACTCTACCCGGGCTCGGTTCCTTCCAATGGGAGCATGTGTCTCTCTTTTAGTAATGTTCTTCTTCTTTGACTCAG TTCAAGTAGTTTTTACAATATGTACAGCAGTTCTTGCAACGATAGCTTTTGCTTTTCTTCTCCTCCCGATGTGCCA GTATTTAACAAGACCCTGCTCACCTCAGAACAAGATTTCCTTTGGTTGCTGTGGACGTTTCACTGCTGCTGAGTTG CTGTCATTCTCTCTGTCTGTCATGCTCGTCCTCATCTGGGTTCTCACTGGCCATTGGCTTCTCATGGATGCACTGG CCATGGGCCTCTGTGTCGCCATGATCGCCTTTGTCCGCCTGCCGAGCCTCAAGGTCTCCTGCCTGCTTCTCTCAGG GCTTCTCATCTATGATGTCTTTTGGGTATTTTTCTCAGCCTACATCTTCAATAGCAACGTCATGGTGAAGGTGGCC ACTCAGCCGGCTGACAATCCCCTTGACGTTCTATCCCGGAAGCTCCACCTGGGGCCCAATGTTGGGCGTGATGTTC CTCGCCTGTCTCTGCCTGGAAAACTGGTCTTCCCAAGCTCCACTGGCAGCCACTTCTCCATGTTGGGCATCGGAGA CATCGTTATGCCTGGTCTCCTACTATGCTTTGTCCTTCGCTATGACAACTACAAAAAGCAAGCCAGTGGGGACTCC TGTGGGGCCCCTGGACCTGCCAACATCTCCGGGCGCATGCAGAAGGTCTCCTACTTTCACTGCACCCTCATCGGAT ACTTTGTAGGCCTGCTCACTGCTACTGTGGCGTCTCGCATTCACCGGGCCGCCCAGCCCGCCCTTCTCTATTTGGT GCCATTTACTTTATTGCCACTCCTCACGATGGCCTATTTAAAGGGCGACCTCCGGCGGATGTGGTCTGAGCCTTTC CACTCCAAGTCCAGCAGCTCCCGATTCCTGGAAGTATGATGGAT Without a crystal structure Amino acid sequence: MAEQTYSWAYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGEQEPIIGFQPMDSTRARF LPMGACVSLLVMFFFFDSVQVVFTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISFGCCGRFTAAELLSFSLSV MLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNP LDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPA NISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFHSKSSSS RFLEV Without a crystal structure Secondary structure prediction: Query-name: SSPL3 Query-length: 385 MAEQTYSWAYSLVDSSQVSTFLISILLIVYGSFRSLNMDFENQDKEKDSNSSSGSFNGEQ CCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC EPIIGFQPMDSTRARFLPMGACVSLLVMFFFFDSVQVVFTICTAVLATIAFAFLLLPMCQ CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH YLTRPCSPQNKISFGCCGRFTAAELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIA HCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH FVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGP HHCCCCHHHHHHHHHHHHHHHHEHHEECHHHCCCCEEEEEECCCCCCCHHHHHHHCCCCC NVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGA CCEECCCCCCCCCCHCCCCCCCCCCEEECCCCEECHHHHHHEHEHHCHHHHHCCCCCCCC PGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAY CCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH LKGDLRRMWSEPFHSKSSSSRFLEV HHHHHHHHHCCCCCCCCCCCCEECC H = Helix E = Str in addition to C = other http://contact.ics.uci.edu/sspro4.html

Without a crystal structure Hydropathy plot using MPEx Without a crystal structure CASP! Wet lab (protein production, purification, crystallization) Production: overexpression in E. coli, yeast, insect, CHO or human (HEK293) cells Extraction: detergent-extraction from membrane fraction after lysis of cells Purification: chromatographic separation of detergent-solubilized protein (Ni column) Concentration: increasing concentration to 2-20 mg / ml Crystallization: vapor diffusion (sitting drop), cubic lipid phase (CLP) or bicelle setups

Membrane protein crystals Membrane protein crystal diffraction 3 weeks 5 months http://biop.ox.ac.uk/www/lj2002/dd/dd-journal.html X-ray lab: test diffraction quality of crystals Synchrotron: collect diffraction data How are synchrotron x-rays produced

Why cryo (100 K nitrogen stream) data collection Reduces radiation-induced decay Why cryo data collection Cryo-trapping of reaction intermediates Why Cryo data collection Cryo-trapping of reaction intermediates

Why Cryo data collection Cryo-trapping of reaction intermediates

2 F(obs) – F(calc) electron density map 2 F(obs) – F(calc) = F(obs) + [F(obs) – F(calc)] F(obs) – F(calc) electron density map (difference map)

Bell, Allie Arizona Home and Design Managing Editor www.phwiki.com

Bell, Allie Managing Editor

Bell, Allie is from United States and they belong to Arizona Home and Design and they are from  Phoenix, United States got related to this Particular Journal. and Bell, Allie deal with the subjects like Domestic Lifestyle (Regional); Home Decorating; Interior Design

Journal Ratings by Clarke College

This Particular Journal got reviewed and rated by Clarke College and short form of this particular Institution is US and gave this Journal an Excellent Rating.