Crystallization Laboratory The many facets of protein crystallization M230D, Jan

Crystallization Laboratory The many facets of protein crystallization M230D, Jan www.phwiki.com

Crystallization Laboratory The many facets of protein crystallization M230D, Jan

Rabago, Mary, News Anchor has reference to this Academic Journal, PHwiki organized this Journal Crystallization Laboratory The many facets of protein crystallization M230D, January 2011 Crystal structure determination pipeline select protein target clone express crystallize solve deposit in PDB 1) chose gene product, source organism, full length, fragment, or fusion 2) chose vector, tag, location of tag (N or C) 3) Chose host organism, temperature, media, purification scheme 4) Screen 1000 conditions Screen as long as crystal quality 5) collect diffraction data make heavy atom derivative determine heavy atom sites calculate map interpret map refine coordinates 6) publish Joint Center as long as Structural Genomics established. 2000. Statistics reported http://www.jcsg.org/ on Jan 4, 2010. Deposited in PDB: 968 Crystallized: 2128 Solved: 1045 Expressed: 27640 Cloned: 27959 Selected Targets: 33209

Grand Valley State University US www.phwiki.com

This Particular University is Related to this Particular Journal

Why is it necessary to grow crystals Growing a suitable crystal is such a hurdle! In a crystal, the diffraction signal is amplified by the large number of repeating units (molecules). Diffraction intensity is proportional to the number of unit cells in the crystal (Darwin’s as long as mula, 1914). Diffraction from a single molecule is not currently measurable. A 100 mm3 crystal contains 1012 unit cells In a crystal, the ordered, periodic arrangement of molecules produces constructive interference.

When a crystal is ordered, strong diffraction results from constructive interference of photons. Incident X-ray crystal Irregularity in orientation or translation limits the order in addition to usefulness of a crystal. Rotational disorder Translational disorder Perfect order Disorder destroys the periodicity leading to Streaky, weak, fuzzy, diffraction. Irregularity in orientation or translation limits the order in addition to usefulness of a crystal. Rotational disorder Translational disorder Perfect order Disorder destroys the periodicity leading to Streaky, weak, fuzzy, diffraction. (CCML, Yeates Lab) (bacteriorhodopsin, Bowie Lab)

What makes crystallization such a difficult challenge DGcrystal=DHcrystal-T(DSprotein+DSsolvent) protein crystal protein in solution Is DHcrystal favorable Enthalpic term Entropic term Yes, DHcrystal is modestly favorable (0 to -17 kcal/mol) large area specific rigid lattice contacts protein crystal protein in solution

Is TDSprotein favorable protein crystal protein in solution No, TDSprotein is strongly unfavorable (+7 to +25 kcal/mol) protein crystal protein in solution 3 degrees of freedom in orientation 3 degrees of freedom in translation 0 degrees of freedom in orientation 0 degrees of freedom in translation Is TDSsolvent favorable protein crystal protein in solution

Yes, TDSsolvent is favorable (-7.5 to -50 kcal/mol) protein crystal protein in solution 3 degrees of freedom in orientation 3 degrees of freedom in translation 0 degrees of freedom in orientation 0 degrees of freedom in translation DGcrystal=DHcrystal-T(DSprotein+DSsolvent) DGcrystal= -small + large – large DGcrystal= -small Strategies to lessen the entropic penalty, TDSprotein. Eliminate floppy, mobile termini (cleave His tags) Express individual domains separately in addition to crystallize separately, or Add a lig in addition to (or protein binding partners) that bridges the domains in addition to locks them together. Mutate high entropy residues (Glu, Lys) to Ala.

Increase [protein] to favor crystallization DG N soluble lysozyme molecules nMMn 1 crystal (lysozyme)N Increasing the monomer concentration [M] pushes the equilibrium toward the product. nMMn DG=DGo+RTln( [Mn]/[M]n ) Lesson: To crystallize a protein, you need to increase its concentration to exceed its solubility (by 3x). Force the monomer out of solution in addition to into the crystal. Supersaturate! Unstable nucleus Three steps to achieve supersaturation. 1) Maximize concentration of purified protein Centricon-centrifugal as long as ce Amicon-pressure Vacuum dialysis Dialysis against high molecular weight PEG Ion exchange. Slow! Avoid precipitation. Co-solvent or low salt to maintain native state. Concentrate protein Three steps to achieve supersaturation. 2) Add a precipitating agent Polyethylene glycol PEG 8000 PEG 4000 High salt concentration (NH4)2SO4 NaH2PO4/Na2HPO4Polyethylene glycol Small organics ethanol Methylpentanediol (MPD) PEG Polymer of ethylene glycol Precipitating agents monopolize water molecules, driving proteins to neutralize their surface charges by interacting with one another. It can lead to (1) amorphous precipitate or (2) crystals.

Three steps to achieve supersaturation. 3) Allow vapor diffusion to dehydrate the protein solution Hanging drop vapor diffusion Sitting drop vapor diffusion Dialysis Liquid-liquid interface diffusion Note: Ammonium sulfate concentration is 2M in reservoir in addition to only 1M in the drop. With time, water will vaporize from the drop in addition to condense in the reservoir in order to balance the salt concentration.—SUPERSATURATION is achieved! 2M ammonium sulfate Drop =½ protein + ½ reservoir Naomi E Chayen & Emmanuel Saridakis Nature Methods – 5, 147 – 153 (2008)Published online: 30 January 2008; doi:10.1038/nmeth.f.203 Precitating agent concentration Conventionally, try shotgun screening first, then systematic screening Shotgun- as long as finding initial conditions, samples different preciptating agents, pHs, salts. Systematic- as long as optimizing crystallization conditions. First commercially Available crystallization Screening kit. Hampton Crystal Screen 1

Rabago, Mary Noticias 33 at 5 PM - KTVW-TV News Anchor www.phwiki.com

The details of the experiment. Goal: crystallize Proteinase K in addition to its complex with PMSF Number of amino acids: 280 Molecular weight: 29038.0 Theoretical pI: 8.20 Non-specific serine protease frequently used as a tool in molecular biology. PMSF is a suicide inhibitor. Toxic! MAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASH PEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGS GQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVA VAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILST WIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPF GTVNLLAYNNYQA Ala (A) 33 11.8% Arg (R) 12 4.3% Asn (N) 17 6.1% Asp (D) 13 4.6% Cys (C) 5 1.8% Gln (Q) 7 2.5% Glu (E) 5 1.8% Gly (G) 33 11.8% His (H) 4 1.4% Ile (I) 11 3.9% Leu (L) 14 5.0% Lys (K) 8 2.9% Met (M) 6 2.1% Phe (F) 6 2.1% Pro (P) 9 3.2% Ser (S) 37 13.2% Thr (T) 22 7.9% Trp (W) 2 0.7% Tyr (Y) 17 6.1% Val (V) 19 6.8% Reservoir Solutions We are optimizing two types of crystals. ProK (rows AB) ProK+PMSF (rows CD). There are three components to each reservoir: (NH4)2SO4, Tris buffer, in addition to water. We are screening six concentrations of ammonium sulfate in addition to 2 buffer pHs. Pipet one chemical to all reservoirs be as long as e pipeting next chemical—it saves tips. Linbro or VDX plate ProK ProK+ PMSF ( (

Practical Considerations When reservoirs are ready, lay 6 coverslips on the tray lid, Then pipet protein in addition to corresponding reservoir on slips Invert slips over reservoir. Only 6 at a time, or else dry out. tray containing reservoir solutions Gently swirl tray to mix reservoir solutions. tray lid tray Proper use of the pipetor. Which pipetor would you use as long as delivering 320 uL of liquid P1000 P200 P20

Be as long as e 2000, trial & error was the primary method of heavy atom screening Pick a heavy atom compound hundreds to chose from Soak a crystal Most of the time the heavy atom will crack the crystal. If crystal cracks, try lower concentration or soak as long as less time. Surviving crystal are sent as long as data collection. Collect a data set Compare diffraction intensities between native in addition to potential derivative. Enormously wasteful of time in addition to resources. Crystals are expensive to make. How many crystallization plates does it take to find a decent heavy atom derivative Heavy Atom Gel Shift Assay Specific binding affects mobility in native gel. Compare mobility of protein in presence in addition to absence of heavy atom. Heavy atoms which produce a gel shift are good c in addition to idates as long as crystal soaking Collect data on soaked crystals in addition to compare with native. Assay per as long as med on soluble protein, not crystal. None Hg Au Pt Pb Sm Procedures Just incubate protein with heavy atom as long as a minute. Pipet 3 uL of protein on parafilm covered plate. Pipet 1 uL of heavy atom (100 mM) as specified. Give plate to me to load on gel. Run on a native gel We use PhastSystem Reverse Polarity electrode Room BH269 (Yeates Lab)

Rabago, Mary News Anchor

Rabago, Mary is from United States and they belong to Noticias 33 at 5 PM – KTVW-TV and they are from  Phoenix, United States got related to this Particular Journal. and Rabago, Mary deal with the subjects like Local News

Journal Ratings by Grand Valley State University

This Particular Journal got reviewed and rated by Grand Valley State University and short form of this particular Institution is US and gave this Journal an Excellent Rating.